CAT# | AF2321 |
Sequence | TMKKPLLLLFFFGTISLSLCEQERDADEEEGSE |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Margatoxin (MgTX) is a 39 amino acid peptide with significant sequence homology to charybdotoxin (ChTX), and ha ...
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...
Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...
Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...
Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...