CAT# | A13340 |
M.W/Mr. | 5910.7 |
Sequence | VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTY |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...
Linaclotide, sold under the brand name Linzess, is a synthetic tetradecapeptide and guanylate cyclase (GC-C) rec ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...