[Ala11,22,28]-VIP (human, bovine, porcine, rat)
[Ala11,22,28]-VIP (human, bovine, porcine, rat)
Online Inquiry
| CAT# | V02015 |
| M.F/Formula | C139H231N43O39S |
| M.W/Mr. | 3160.72 |
| Sequence | HSDAVFTDNYARLRKQMAVKKALNSILA-NH2 |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| V1302 |
(Pyr16)-VIP (16-28) (chicken) |
|
|
Inquiry |
| V1312 |
Biotinyl-VIP (human, mouse, rat) |
|
|
Inquiry |
| V02018 |
[Lys1, Pro2,5,Arg3,4,Tyr6] VIP, human, porcine, rat, ovine |
|
|
Inquiry |
| V02013 |
PHI-27 (rat) |
|
|
Inquiry |
| V1307 |
(p-Chloro-D-Phe6,Leu17)-VIP (human, mouse, rat) |
|
|
Inquiry |
Write a review
Ask a question
My Review for [Ala11,22,28]-VIP (human, bovine, porcine, rat)
Required fields are marked with *
×
Ask a Question for [Ala11,22,28]-VIP (human, bovine, porcine, rat)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
