CAT# | V02015 |
M.F/Formula | C139H231N43O39S |
M.W/Mr. | 3160.72 |
Sequence | HSDAVFTDNYARLRKQMAVKKALNSILA-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Growth hormone releasing factor (GRF) (human) acetate is an acetate salt of an amidated synthetic 29-amino acid ...
Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...
BA 1 (DTyr-Gln-Trp-Ala-Val- Ala-His-Phe-Nle-NH2) is a potent BRS-3 agonist (IC50 = 2.52 nM) and a NMBR and GRPR ...
Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...