PHI-27 (rat)
Online Inquiry
| CAT# | V02013 |
| M.F/Formula | C136H216N36O41 |
| M.W/Mr. | 3011.43 |
| Sequence | HADGVFTSDYSRLLGQISAKKYLESLI-NH2 |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| V02020 |
[pGlu16]-VIP (16-28), porcine |
|
|
Inquiry |
| V02023 |
VIP-Lys(Biotin), human, porcine, rat |
|
|
Inquiry |
| V02021 |
Biotinyl-VIP (human, mouse, rat) trifluoroacetate salt |
|
|
Inquiry |
| V02015 |
[Ala11,22,28]-VIP (human, bovine, porcine, rat) |
|
|
Inquiry |
| V02004 |
(Pyr-16)-VIP (16-28) (chicken) |
|
|
Inquiry |
Write a review
Ask a question
My Review for PHI-27 (rat)
Required fields are marked with *
×
Ask a Question for PHI-27 (rat)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
