Keywords Search Google Search Search

Acidic peptide 1-2

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	B11005
Sequence	LEAAMRDLDSFEHPEEASEKETRGFNQEEKE

CAT#	Product Name	Inquiry
T05027	Protein C (HPC) Epitope	Inquiry
X09746	PM_18979362	Inquiry
X01637	PH1PO071_06	Inquiry
X08908	PM_17551579	Inquiry
X20739	UP_Q868F8	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Introduction of Orexin A

Orexin A (OXA) and orexin B (OXB) are hypothalamic neuropeptides discovered in 1998, which bind to two G-protein ...

C 21, a selective protein arginine methyltransferase 1 inhibitor

C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...

Linear Heptapeptide Antagonist, GR 94800

GR 94800, is a linear heptapeptide with the structure of PhCO-Ala-Ala-D-Trp-Phe-D-Pro-Nle Amide, which is a high ...

The role of Act1 in NF-кB activation

NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...

Progress of Clinical Research on Trofinetide

Development of Trofinetide Trofinetide was found in 2002 by Brimble's team at the University of Auckland i ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: