CAT# | B10003 |
M.F/Formula | C152H253N51O44S4 |
M.W/Mr. | 3627.26 |
Sequence | YSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...
Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...
Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...
Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...