We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
CAT No:T2814
CAS No:77591-33-4
Synonyms/Alias:FX (human, bovine, horse, rat)
Quick InquiryPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C212H350N56O78S |
M.W/Mr. | 4963.49 |
Sequence | One Letter Code: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Biological Activity | Naturally occuring, potent regulator of actin polymerization present in human platelets at a concentration of 200 - 500 μM. Sequesters G-actin monomers in a 1:1 ratio (Kd = 0.7 - 1.0 μM) and allows rapid filament polymerization in the presence of profilin. Implicated in wound healing, induction of MMPs, chemotaxis, angiogenesis, inflammatory processes and tumor progression. |
Length | 43 |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com