Thymosin beta4(human, bovine, horse, rat)

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Custom Peptide Synthesis

CAT No:T2814

CAS No:77591-33-4

Synonyms/Alias:FX (human, bovine, horse, rat)

Quick Inquiry

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC212H350N56O78S
M.W/Mr.4963.49
SequenceOne Letter Code: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Biological ActivityNaturally occuring, potent regulator of actin polymerization present in human platelets at a concentration of 200 - 500 μM. Sequesters G-actin monomers in a 1:1 ratio (Kd = 0.7 - 1.0 μM) and allows rapid filament polymerization in the presence of profilin. Implicated in wound healing, induction of MMPs, chemotaxis, angiogenesis, inflammatory processes and tumor progression.
Length43
Shipping ConditionRoom temperature in continental US; may vary elsewhere.
Featured Recommendations
Related Screening Libraries:
Related Small Molecules:
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Products
Hot Products
  • Teriparatide Acetate

    Teriparatide(recombinant human parathyroid hormone) /PTH (1-34) (human) corresponds to the N-terminal part of human parathyroid hormone, a peptide consisting of 84 amino acids.

    Inquiry
  • Sincalide Ammonium Salt

    Sincalide corresponds to the C-terminal octapeptide of cholecystokinin (CCK) and acts on receptors within the gallbladder wall causing it to contract.

    Inquiry
  • GLP-1 (7-37) Acetate

    Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-2 as a gut hormone.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
  • Deslorelin

    Deslorelin is a gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen). It is currently approved for use in veterinary medicine and is used to induce ovulation in mares as part of the artificial insemination process. It is also used to stabilize high-risk pregnancies, mainly of livestock. Unlike other GnRH agonists, which are mainly used to inhibit luteinizing hormone and follicle-stimulating hormone by their ultimate downregulation of the pituitary gland.

    Inquiry
  • GLP-1 (7-36) amide Acetate

    Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. Its physiological functions include promoting insulin sensitivity, decreasing food intake by increasing satiety in brain and increasing insulin secretion from the pancreas in a glucose-dependent manner.

    Inquiry
  • Terlipressin Acetate

    Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research.

    Inquiry
  • Buserelin Acetate

    Buserelin Acetate is an agonist of gonadotropin-releasing hormone receptor(GnRHR). Buserelin is a synthetic luteinizing hormone–releasing hormone (LHRH) analog.

    Inquiry
  • Atosiban

    Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

    Inquiry
  • Teriparatide Acetate

    Teriparatide(recombinant human parathyroid hormone) /PTH (1-34) (human) corresponds to the N-terminal part of human parathyroid hormone, a peptide consisting of 84 amino acids.

    Inquiry
  • Sincalide Ammonium Salt

    Sincalide corresponds to the C-terminal octapeptide of cholecystokinin (CCK) and acts on receptors within the gallbladder wall causing it to contract.

    Inquiry
  • GLP-1 (7-37) Acetate

    Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-2 as a gut hormone.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
  • Deslorelin

    Deslorelin is a gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen). It is currently approved for use in veterinary medicine and is used to induce ovulation in mares as part of the artificial insemination process. It is also used to stabilize high-risk pregnancies, mainly of livestock. Unlike other GnRH agonists, which are mainly used to inhibit luteinizing hormone and follicle-stimulating hormone by their ultimate downregulation of the pituitary gland.

    Inquiry
Get in touch with us

USA

Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

Email: info@creative-peptides.com

 

Germany

Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main

Email: info@creative-peptides.com

Copyright © 2025 Creative Peptides. All rights reserved.

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x