Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GKIPVKAIKKAGAAIGKGLRAINIASTAHDVYSFFKPKHKKK |
Activity | Antibacterial |
Host Chemicals | Bean golden mosaic virus-[Brazil] |
Length | 42 |
SwissProt ID | Q7YZB4 |
1. TMEM16F and dynamins control expansive plasma membrane reservoirs
2. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
3. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.