Peptide Histidine Isoleucinamide (PHI), Porcine (1 - 27)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	G05004
M.W/Mr.	2995.4
Sequence	HADGVFTSDFSRLLGQLSAKKYLESLI-NH2

CAT#	Product Name	Inquiry
X19945	UP_P83317	Inquiry
X14004	PM_7979365	Inquiry
X06046	PM_1373107	Inquiry
X04542	PM_11641910	Inquiry
X10362	PM_1988041	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Cyclosporin A as an Immunosuppressant

Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...

The efficacy of teicoplanin in the treatment of Gram-positive cocci infection

Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...

Cyclotraxin B, A Selective Antagonist of TrkB Receptors

Cyclotraxin B , a potent antagonist of TrkB receptors, inhibits BDNF-induced TrkB activity (IC50 = 0.30 nM). R ...

Function of fertirelin acetate in prostate cancer and other diseases

Fertirelin acetate, classified into peptide hormone, is a gonadotropin-releasing hormone (GnRH) antagonist or ...

Function of dynorphin (1-17) in analgesia

In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: