Peptide Histidine Isoleucinamide (PHI), Porcine (1 - 27)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	G05004
M.W/Mr.	2995.4
Sequence	HADGVFTSDFSRLLGQLSAKKYLESLI-NH2

CAT#	Product Name	Inquiry
X05484	PM_12662311	Inquiry
X00482	PH1AP003_04	Inquiry
X05832	PM_12954649	Inquiry
X13031	PM_7505236	Inquiry
X07657	PM_16163753	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

What is TB 500?

Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...

Introduction of Pentapeptide-3

Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...

Gap 19: Specifically block Cx43 hemichannels inhibitor

Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...

Function of Pep2m in Reducing AMPA Currents

Pep2m, a peptide inhibitor of GluA2 subunit binding to NSF, reduces α-amino- 3-hydroxy-5-methyl-isoxazolepropion ...

β-secretase and γ-Secretase Inhibitors

Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: