CAT# | AF3243 |
Sequence | GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC |
Activity | Gram-, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Delcasertib, also known as KAI-9803, is a 23-amino acid peptide and δ-protein kinase C (δ-PKC) inhibitor. KAI-9 ...
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...
Peptides are compounds formed by linking α-amino acids by peptide bonds, and are intermediate products of proteolysis. They a ...
PAC-113, as well as a new type of Trp-rich peptide, is a 12 amino-acid fragment of the saliva protein histatin 5 ...