Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC |
Activity | Gram-, |
Host Chemicals | North America, Rana palustris |
Length | 48 |
SwissProt ID | SwissProt ID: P84281 |
2. High fat diet and GLP-1 drugs induce pancreatic injury in mice
3. Emu oil in combination with other active ingredients for treating skin imperfections
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.