CAT# | AF2473 |
Sequence | TTLTLHNLCPYPVWWLVTPNNGGFPIIDNTPVVLG |
Activity | Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...
Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...
MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...
NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...
ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...