CAT# | AF3263 |
Sequence | KFCEKPSGTWSGVCGNSGACKDQCIRLEGAKHGSCNYKPPAHRCICYYEC |
Activity | Gram+ & Gram-, Fungi, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Jingzhaotoxin-III (β-TRTX-Cj1α) is a kind of sodium channel gating modifier which is from the tarantula Chilobra ...
Gonadorelin hydrochloride, with the same amino acid sequence as endogenous gonadorelin, which is Pro-His-Trp-Ser ...
Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...
The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...