Nesfatin-1 was recently identified as an anorexigenic peptide and is derived from Nucleobindin2 protein. Nesfatin-1 reduces body weight gain, food and water intake in rodents. In humans high levels of Nesfatin-1 in plasma are associated with overweight individuals. In addition, Nesfatin-1 has been linked to anxiety and stress.
CAT# | N01004 |
M.W/Mr. | 3685.3 |
Sequence | One Letter Code: PDTGLYYDEYLKQVIDVLETDKHFREKLQK-NH2 Three Letter Code: Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Asp-Val-Leu-Glu-Thr-Asp-Lys-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...
The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
Perindopril erbumine is an angiotensioncon vertingenzyme (ACE) inhibitor without sulfhydryl group. It is a chi ...