Keywords Search Google Search Search

[Lys22]-beta-Amyloid (1-40), Italian Mutation

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13274
M.W/Mr.	4328.9
Sequence	DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV

CAT#	Product Name	Inquiry
A13271	[Asn23]-beta-Amyloid (1-40), Iowa Mutation	Inquiry
A13263	[Gly21]-beta-Amyloid (1-40), A21G, Flemish Mutation	Inquiry
CAD-006	Beta-Amyloid (1-40) (S26C) Dimer	Inquiry
A13262	[Asp22] b-Amyloid (1-40)	Inquiry
A13282	[Arg13] b-Amyloid (1-40)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The medicinal value of cetrorelix acetate

Cetrorelix acetate (C70H92ClN17O14, referred to as cetrorelix), a synthetic decapeptide with 5 amino acids in th ...

Function of P11 in a protein chip system

P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...

The mechanism of R18 on 14-3-3 protein

R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...

Function of Urantide in the Rat Aorta

Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...

The therapeutic function of DAPTA

DAPTA (D-[Ala]-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-amide), D-Ala-Peptide T amide, is one of analogue of peptide T, which ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: