Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE |
Activity | Antibacterial |
Host Chemicals | Homo sapiens |
Length | 40 |
SwissProt ID | Q969E1 |
3. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
4. Myotropic activity of allatostatins in tenebrionid beetles
5. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.