Keywords Search Google Search Search

GLP-2 (rat)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	R0838
CAS	195262-56-7
M.F/Formula	C166H256N44O56S
M.W/Mr.	3796.17
Sequence	HADGSFSDEMNTILDNLATRDFINWLIQTKITD
Application	Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.

CAT#	Product Name	Inquiry
S10002	Synaptobrevin-2 (75-78) (human, bovine, mouse, rat)	Inquiry
X06564	PM_14991679	Inquiry
T05037	Protease - Activated Receptor - 4, PAR - 4 Agonist, amide, human	Inquiry
X05005	PM_12061820	Inquiry
X03498	PM_10904553	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Cyclotraxin B, A Selective Antagonist of TrkB Receptors

Cyclotraxin B , a potent antagonist of TrkB receptors, inhibits BDNF-induced TrkB activity (IC50 = 0.30 nM). R ...

The Function of Depreotide in Tumor Receptor Imaging

Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...

The source and function of tripeptide-1 kollaren

of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...

C 21, a selective protein arginine methyltransferase 1 inhibitor

C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...

Conantokin-T, a naturally peptidic NMDA receptor antagonist

Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: