Keywords Search Google Search Search

GLP-2 (rat)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	R0838
CAS	195262-56-7
M.F/Formula	C166H256N44O56S
M.W/Mr.	3796.17
Sequence	HADGSFSDEMNTILDNLATRDFINWLIQTKITD
Application	Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.

CAT#	Product Name	Inquiry
P6630	Ac-Ile-Tyr(PO3H2)-Gly-Glu-Phe-NH2	Inquiry
X19058	UP_P55959	Inquiry
T09048	Sarafotoxin 6c	Inquiry
X14527	PM_8277945	Inquiry
X02775	PM_10508422	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of BIM 189 As An Antagonist

BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...

Orexin Peptides

Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...

The role of Act1 in NF-кB activation

NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...

Peptidic Antagonist to CRF2 Receptor–Astressin 2B

Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...

C 21, a selective protein arginine methyltransferase 1 inhibitor

C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: