GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human
GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human
Online Inquiry
| CAT# | G16008 |
| M.W/Mr. | 3922.4 |
| Sequence | HADGSFSDEMNTILDNLAARDFINWLIQTKITDR |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| G16005 |
Glucagon - Like Peptide 1, GLP - 1 (7 - 37) |
|
|
Inquiry |
| CAD-111 |
GLP-1(7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) |
|
|
Inquiry |
| G16012 |
(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) |
|
|
Inquiry |
| G05010 |
Oxyntomodulin / Glucagon 37 |
|
|
Inquiry |
| G16003 |
(Ser8)-GLP-1 (7-36), amide, human |
|
|
Inquiry |
Write a review
Ask a question
My Review for GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human
Required fields are marked with *
×
Ask a Question for GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
