CAT# | G16008 |
M.W/Mr. | 3922.4 |
Sequence | HADGSFSDEMNTILDNLAARDFINWLIQTKITDR |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...
Perindopril erbumine is an angiotensioncon vertingenzyme (ACE) inhibitor without sulfhydryl group. It is a chi ...
The cyclopentapeptide FC 131 (cyclo(-L-Arg1-L-Arg2-L-2-Nal3-Gly4-D-Tyr5-), 2-Nal=3-(2-naphthyl) alanine)) is an ...
Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...