GLP-1(7-36) Acetate
GLP-1(7-36) Acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.
Online Inquiry
| CAT# | 10-101-293 |
| CAS | 1119517-19-9 |
| Synonyms/Alias | Human GLP-1-(7-36)-amide Acetate |
| M.F/Formula | C149H226N40O45.xC2H4O2 |
| M.W/Mr. | 3394.67 |
| Sequence | One Letter Code: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Three Letter Code: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Purity | > 98% |
| Storage | Store at -20°C. |
Solubility | H2O : 50 mg/mL (14.73 mM; Need ultrasonic)
DMSO : < 1 mg/mL (insoluble or slightly soluble) |
Shipping Condition | Wet ice in continental US; may vary elsewhere |
Write a review
Ask a question
My Review for GLP-1(7-36) Acetate
Required fields are marked with *
×
Ask a Question for GLP-1(7-36) Acetate
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
