CAT# | G01015 |
M.F/Formula | C141H211N43O41 |
M.W/Mr. | 3164.5 |
Sequence | GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...
Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...
Palmitoyl Pentapeptide, a peptide with significant biological activity, has attracted attention for its anti-aging effect on ...
What is Trofinetide? Trofinetide is a neuropeptide synthesized from the breakdown product of insulin-like grow ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...