CAT# | E10001 |
M.F/Formula | C149H234N40O47S1 |
M.W/Mr. | 3369.8 |
Sequence | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...
The endocytosis of AMPA receptors (AMPARs) requires the GTPase activity of dynamin. Since it is now established ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...