Keywords Search Google Search Search

EF-hand 4

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	V10004
Sequence	TPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSI

CAT#	Product Name	Inquiry
X06464	PM_1475012	Inquiry
X13529	PM_7686363	Inquiry
F1101	Z-Phe-DL-Ala-fluoromethylketone	Inquiry
X20753	UP_Q8BGU2	Inquiry
P37005	Gamma-SG neuropeptide	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Obtustatin: a potent selective α1β1 inhibitor

Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...

NK tachykinin receptor selective antagonist-MDL 29,913

In the respiratory tract, there are tachykinin P (SP) and neurokinin A (NKA) in capsaicin-sensitive primary affe ...

Tachykinin NK2 receptor antagonist-MEN 10376

MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...

What is GHK and Copper Peptide?

Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...

Function of BIM 189 As An Antagonist

BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: