Corticotropin (ACTH or adrenocorticotropic hormone) is a polypeptide hormone produced and secreted by the pituitary gland. It is an important player in the hypothalamic-pituitary-adrenal axis.
CAT# | 10-101-167 |
CAS | 9002-60-2,12427-33-7 |
Background | Corticotropin-releasing hormone (CRH) (also known as corticotropin-releasing factor (CRF) or corticoliberin; is a 41-amino acid peptide derived from a 196-amino acid preprohormone. Corticotropin may also be spelled corticotrophin) is a peptide hormone involved in the stress response. It is a releasing hormone that belongs to corticotropin-releasing factor family. In humans, it is encoded by the CRH gene. Its main function is the stimulation of the pituitary synthesis of ACTH, as part of the HPA Axis. Increased CRH production has been observed to be associated with Alzheimer's disease and major depression, and autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia. >> Read More |
Synonyms/Alias | Adrendcorticotrophic hormone;ACTH;ACTH (1-39);Acthar;Adrenocorticotrophin;Adrenocorticotropic hormone;Corticotrophin;H.P. acthar gel |
M.F/Formula | C207H308N56O58S |
M.W/Mr. | 4541.06582 |
Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
Labeling Target | Adrenocorticotropic hormone receptor |
Application | Corticotropin is for use as a diagnostic agent in the screening of patients presumed to have adrenocortical insufficiency. |
Activity | Agonist |
Biological Activity | Corticotropin is a diagnostic agent used in the screening of patients presumed to have adrenocortical insufficiency. |
Areas of Interest | Neurological Disease |
Functions | Melanocortin receptor activity |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Cetrorelix acetate (C70H92ClN17O14, referred to as cetrorelix), a synthetic decapeptide with 5 amino acids in th ...
The cyclopentapeptide FC 131 (cyclo(-L-Arg1-L-Arg2-L-2-Nal3-Gly4-D-Tyr5-), 2-Nal=3-(2-naphthyl) alanine)) is an ...
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...
APETx2, a 42 amino-acid peptide toxin isolated from sea anemone Anthopleura elegantissima, is a kind of acid-s ...
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...