Corticotropin (ACTH or adrenocorticotropic hormone) is a polypeptide hormone produced and secreted by the pituitary gland. It is an important player in the hypothalamic-pituitary-adrenal axis.
CAT# | 10-101-167 |
CAS | 9002-60-2,12427-33-7 |
Background | Corticotropin-releasing hormone (CRH) (also known as corticotropin-releasing factor (CRF) or corticoliberin; is a 41-amino acid peptide derived from a 196-amino acid preprohormone. Corticotropin may also be spelled corticotrophin) is a peptide hormone involved in the stress response. It is a releasing hormone that belongs to corticotropin-releasing factor family. In humans, it is encoded by the CRH gene. Its main function is the stimulation of the pituitary synthesis of ACTH, as part of the HPA Axis. Increased CRH production has been observed to be associated with Alzheimer's disease and major depression, and autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia. >> Read More |
Synonyms/Alias | Adrendcorticotrophic hormone;ACTH;ACTH (1-39);Acthar;Adrenocorticotrophin;Adrenocorticotropic hormone;Corticotrophin;H.P. acthar gel |
M.F/Formula | C207H308N56O58S |
M.W/Mr. | 4541.06582 |
Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
Labeling Target | Adrenocorticotropic hormone receptor |
Application | Corticotropin is for use as a diagnostic agent in the screening of patients presumed to have adrenocortical insufficiency. |
Activity | Agonist |
Biological Activity | Corticotropin is a diagnostic agent used in the screening of patients presumed to have adrenocortical insufficiency. |
Areas of Interest | Neurological Disease |
Functions | Melanocortin receptor activity |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...
Basic Fibroblast Growth Factor, Human, called basic fibroblast growth factor (bFGF/FGF-b/FGF-2), is a single cha ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...