CAT# | AF2375 |
Sequence | LFCKGGSCHFGGCPSHLIKVGSCFRSCCKWPWNA |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...
GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...
(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...