Charybdotoxin is a peptide found in the venom of the scorpion Leiurus quinquestriatus. Specific inhibitor of the big conductance Ca2+-activated K+ channel.
CAT# | R1820 |
CAS | 95751-30-7 |
Synonyms/Alias | ChTx |
M.F/Formula | C176H277N57O55S7 |
M.W/Mr. | 4295.95 |
Sequence | One Letter Code: XFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Modifications: X-1 = Glp; Disulfide bonds: 7-28, 13-33, 17-35) Three Letter Code: Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Pep2m, a peptide inhibitor of GluA2 subunit binding to NSF, reduces α-amino- 3-hydroxy-5-methyl-isoxazolepropion ...
Development of Trofinetide Trofinetide was found in 2002 by Brimble's team at the University of Auckland i ...
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...