Charybdotoxin
Charybdotoxin is a peptide found in the venom of the scorpion Leiurus quinquestriatus. Specific inhibitor of the big conductance Ca2+-activated K+ channel.
Online Inquiry
| CAT# | R1820 |
| CAS | 95751-30-7 |
| Synonyms/Alias | ChTx |
| M.F/Formula | C176H277N57O55S7 |
| M.W/Mr. | 4295.95 |
| Sequence | One Letter Code: XFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Modifications: X-1 = Glp; Disulfide bonds: 7-28, 13-33, 17-35)
Three Letter Code: Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser |
| Length | 37 |
Storage | Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. |
Solubility | Soluble to 1 mg/ml in water |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
InChI Key | CNVQLPPZGABUCM-UHFFFAOYSA-N |
Canonical SMILES | [H]N1[C@@H](CCC1=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC3=CNC=N3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CC1=CNC4=C1C=CC=C4)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O)[C@@H](C)O |
Modifications | disulfide |
Write a review
Ask a question
My Review for Charybdotoxin
Required fields are marked with *
×
Ask a Question for Charybdotoxin
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
