CAT# | AF2348 |
Sequence | GFSSLFKAGAKYLLKSVGKAGAQQLACKAANNCA |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...
of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...