Botulinum Neurotoxin (BoNT) B Substrate Modification,amide, FITC - labeled

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	T09019
M.W/Mr.	4516
Sequence	FITCLCLSELDDRADALQAGASQFESSAAKLKRKYWWKNLK-NH2

CAT#	Product Name	Inquiry
X15509	PM_8875645	Inquiry
X20664	UP_Q6Y4S4	Inquiry
X04272	PM_11431424	Inquiry
X18258	UP_P14462	Inquiry
X05812	PM_12941482	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The source and function of tripeptide-1 kollaren

of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...

The application of obestatin (human) in hormonal therapy

Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...

Function of sinapultide in respiratory distress syndrome

Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...

Function of Kassinin in Stimulating Ion Transport in Skin

Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...

Effects of tripeptide-3 in skin

Neurotransmitter Inhibitor Peptides Peptides used in topical anti-aging products have multiple applications. Gorouhi and Maib ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: