AmmTX3

AamTx3 is a blocker of KV4 channel, which blocks A-type K+ current (ISA) in mouse cerebellar granule neurons.

Online Inquiry

CAT#R0861
M.F/FormulaC158H262N50O48S6
M.W/Mr.3822.47
SequenceXIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP(Modifications: X = Glp, Disulfide bridge: 8-28,13-33,17-35)
Labeling TargetKV4 K+ channels
ApplicationBy blocking specifically the Kv4 channels, AmmTX3 reduces the A-type potassium current through these channels almost completely.
Purity>98 %
ActivityBlocker
Quick Inquiry
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

  Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...

 The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...

Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...

 Carnosine (β-alanyl-l-histidine), containing an imidazole moiety, is an intramuscular dipeptide consisting of β ...

 BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Copyright © 2024 Creative Peptides. All rights reserved.