AamTx3 is a blocker of KV4 channel, which blocks A-type K+ current (ISA) in mouse cerebellar granule neurons.
CAT# | R0861 |
M.F/Formula | C158H262N50O48S6 |
M.W/Mr. | 3822.47 |
Sequence | XIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP(Modifications: X = Glp, Disulfide bridge: 8-28,13-33,17-35) |
Labeling Target | KV4 K+ channels |
Application | By blocking specifically the Kv4 channels, AmmTX3 reduces the A-type potassium current through these channels almost completely. |
Purity | >98 % |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...
Growth hormone releasing factor (GRF) (human) acetate is an acetate salt of an amidated synthetic 29-amino acid ...
PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...