AamTx3 is a blocker of KV4 channel, which blocks A-type K+ current (ISA) in mouse cerebellar granule neurons.
CAT# | R0861 |
M.F/Formula | C158H262N50O48S6 |
M.W/Mr. | 3822.47 |
Sequence | XIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP(Modifications: X = Glp, Disulfide bridge: 8-28,13-33,17-35) |
Labeling Target | KV4 K+ channels |
Application | By blocking specifically the Kv4 channels, AmmTX3 reduces the A-type potassium current through these channels almost completely. |
Purity | >98 % |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...
Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...
Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...
Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...
Cetrorelix acetate (C70H92ClN17O14, referred to as cetrorelix), a synthetic decapeptide with 5 amino acids in th ...