CAT# | O09001 |
Sequence | SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSR |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
What is Trofinetide? Trofinetide is a neuropeptide synthesized from the breakdown product of insulin-like grow ...
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...