CAT# | AF3167 |
Sequence | RECKAQGRHGTCFRDANCVQVCEKQAGWSHGDCRAQFKCKCIFEC |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
10Panx is a panx 1 mimetic inhibitor that easily and reversibly inhibits panx1 currents. In cells that are diffi ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...