CAT# | AF3148 |
Sequence | GIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...
(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...