CAT# | AF2357 |
Sequence | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
Activity | Gram+ & Gram-, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
APETx2, a 42 amino-acid peptide toxin isolated from sea anemone Anthopleura elegantissima, is a kind of acid-s ...
Tetracosactide (also known as Tetracosactide) is a synthetic peptide that is identical to the 24-amino acid segm ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...
AdTx1, also called as ρ-Da1a, is a polypeptide of 65 amino acids stabilized by four disulfide bonds, which has a ...
MCL 0020 is a synthetic tripeptide with the structure of Ac-D-2Nal-Arg-2Nal-NH2 (2-Nal= 3-(2-naphthyl)-L-alanine ...