CAT# | AF2394 |
Sequence | TMKKSLLFFFFLGTISLSLCEQERGADEDDGVEE |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Palmitoyl Pentapeptide, a peptide with significant biological activity, has attracted attention for its anti-aging effect on ...
Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
What are oligopeptides? Oligopeptides, usually refer to short-chain polypeptides formed by the linkage of 2 to 20 amino acid ...