CAT# | AF1860 |
Sequence | ACYCRIPACFAGERRYGTCFYLGRVWAFCC |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...
What are copper peptides? Copper peptides are tripeptide molecules composed of three amino acids that combine with copper io ...
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...
Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...