Effective irreversible antagonist of αVβ3 integrin that disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC50 = 0.1 nM).
CAT# | R0941 |
CAS | 154303-05-6 |
M.F/Formula | C217H341N71O74S9 |
M.W/Mr. | 5417.1 |
Sequence | ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT(Disulfide bridge between Cys2 and Cys11, Cys7 and Cys32, Cys8 and Cys37, Cys20 and Cys39) |
Labeling Target | αVβ3 integrin |
Appearance | White lyophilised solid |
Purity | >98% |
Activity | Antagonist |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...
KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...
Deslorelin acetate, marketed under the trade names Ovuplant, SucroMate and Suprelorin, is an injectable gonadotr ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...