CAT# | AF2564 |
Sequence | DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...
Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
What are oligopeptides? Oligopeptides, usually refer to short-chain polypeptides formed by the linkage of 2 to 20 amino acid ...
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...