CAT# | AF2309 |
Sequence | SLGSFMKGVGKGLATVGKIVADQFGKLLEAGQG |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...
Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...
of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...