CAT# | AF1919 |
Sequence | GIPCGESCVWIPCISAAIGCSCKSKVCYRN |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...
Eptifibatide acetate is a white or white-off powder, soluble in water and freely soluble in 1% acetic in water, ...
Nafarelin acetate is a gonadotropin-releasing hormone (GnRH) agonist which is as effective as danazol in the tre ...