CAT# | AF2099 |
Sequence | GIPCAESCVWIPPCTITALMGCSCKNNVCYNN |
Activity | Cancer cells |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
Deslorelin acetate, marketed under the trade names Ovuplant, SucroMate and Suprelorin, is an injectable gonadotr ...