Calcitonin Gene Related Peptide, rat

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	C05045
CAS	11118-25-5
M.F/Formula	C148H228N40O46S3
M.W/Mr.	3399.9
Sequence	One Letter Code: CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (C1&C7 bridge) three Letter Code: H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (trifluoroacetate salt)(Cys1 and 7 bridge)

CAT#	Product Name	Inquiry
C05033	Biotinyl-alpha-CGRP (human)	Inquiry
C05010	α-CGRP (8-37) (canine, mouse, rat)	Inquiry
C05035	CGRP (chicken)	Inquiry
C05027	(Cys(Acm)2·7)-alpha-CGRP (human)	Inquiry
C05024	α-CGRP (31-37) (canine, mouse, rat)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of peptide YY (3-36) in ingestion behavior

Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...

Potent blocker of voltage-gated sodium channels-Phrixotoxin 3

The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...

UT receptor peptide antagonist-UFP 803

UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...

Function of DAMME in analgesia

DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...

Palmitoyl tripeptide: A breakthrough ingredient in skin care science

With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Source#	Synthetic
Storage	-20 ± 5 °C