Calcitonin Gene Related Peptide, rat
Calcitonin Gene Related Peptide, rat
Online Inquiry
| CAT# | C05045 |
| CAS | 11118-25-5 |
| M.F/Formula | C148H228N40O46S3 |
| M.W/Mr. | 3399.9 |
| Sequence | One Letter Code: CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (C1&C7 bridge)
three Letter Code: H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (trifluoroacetate salt)(Cys1 and 7 bridge) |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for Calcitonin Gene Related Peptide, rat
Required fields are marked with *
×
Ask a Question for Calcitonin Gene Related Peptide, rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
