CAT# | AF3154 |
Sequence | KSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGLSCPKDFPK |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...
of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...
Palmitoyl Pentapeptide, a peptide with significant biological activity, has attracted attention for its anti-aging effect on ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...