We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
CAT# | AF2026 |
Sequence | GMSGYIQGIPDFLKGYLHGISAANKHKKGRL |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...
Eptifibatide acetate is a white or white-off powder, soluble in water and freely soluble in 1% acetic in water, ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
What is GIP? GIP (Gastric Inhibitory Polypeptide or Glucose-dependent Insulinotropic Peptide) is a peptide hormone composed ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...