CAT# | AF3111 |
Sequence | NKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCWCET |
Activity | Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...
Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...
Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...
Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...
Dipeptide diaminobutyroyl benzylamide diacetate, often marketed under the name Syn-Ake, is a synthetic peptide that mimics th ...