CAT# | A13283 |
M.F/Formula | C195H300N56O56S1 |
M.W/Mr. | 4357.0 |
Sequence | DAEFRHDSGYEVHHQKLVFFARDVGSNKGAIIGLMVGGVV |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...
MCL 0020 is a synthetic tripeptide with the structure of Ac-D-2Nal-Arg-2Nal-NH2 (2-Nal= 3-(2-naphthyl)-L-alanine ...