Amyloid β-peptide (1-40) rat
Amyloid β-peptide (1-40) rat
Amyloid β-peptide (1-40) (rat) is the prone-to-aggregation product of amyloid precursor protein proteolytic cleavage, and is the major constituent of senile plaques observed in the brain of Alzheimer's disease.
Online Inquiry
| CAT# | R1192 |
| CAS | 144409-98-3 |
| M.F/Formula | C₁₉₀H₂₉₁N₅₁O₅₇S |
| M.W/Mr. | 4233.76 |
| Sequence | One Letter Code: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
three Letter Code: Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
Write a review
Ask a question
My Review for Amyloid β-peptide (1-40) rat
Required fields are marked with *
×
Ask a Question for Amyloid β-peptide (1-40) rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
