Adrenomedullin (11-50), rat
Adrenomedullin (11-50), rat
Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors.
Online Inquiry
| CAT# | R1169 |
| CAS | 163648-32-6 |
| M.F/Formula | C₁₉₄H₃₀₄N₅₈O₅₉S₄ |
| M.W/Mr. | 4521.17 |
| Sequence | One Letter Code: STGCRFGTCTMQKLAHQIYQFTDKDKDGMAP RNKISPQGY-NH2(Disulfide bridge: Cys4-Cys9)
three Letter Code: Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfide bridge: Cys4-Cys9) |
| Length | 40 |
Modifications | Disulfide |
Write a review
Ask a question
My Review for Adrenomedullin (11-50), rat
Required fields are marked with *
×
Ask a Question for Adrenomedullin (11-50), rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
