CAT# | AF3228 |
Sequence | QICKAPSQTFPGLCFMDSSCRKYCIKEKFTGGHCSKLQRKCLCTKPC |
Activity | Fungi, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...
Glutathione (γ-Glu-Cys-Gly, GSH) is the most abundant antioxidant in animal tissues, at 0.1-10 mM, as well as i ...
ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...
Compstatin is a 13-residue cyclic peptide (Ile1-Cys2-Val3-Val4-Gln5-Asp6-Trp7-Gly8-His9-His10-Arg11-Cys12-Thr13- ...
What is palmitoyl tripeptide-38? Palmitoyl tripeptide-38 (PT-38), named MATRIXYL synthe'6 and Volulip, a cosmetic peptide or ...