CAT# | P15002 |
Sequence | IYCGFGGTVPAGDGCNFCFCTPLGTIGTCTMRRCDSLS |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
Deslorelin acetate, marketed under the trade names Ovuplant, SucroMate and Suprelorin, is an injectable gonadotr ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Anisomycin, also known by its trade name flagecidin, is a bacterial pyrrolidine antibiotic mostly isolated from ...