Peptide YY (PYY), human
Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors.
Online Inquiry
| CAT# | R1612 |
| CAS | 118997-30-1 |
| M.F/Formula | C₁₉₄H₂₉₅N₅₅O₅₇ |
| M.W/Mr. | 4309.75 |
| Sequence | One Letter Code: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
three Letter Code: Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
Write a review
Ask a question
My Review for Peptide YY (PYY), human
Required fields are marked with *
×
Ask a Question for Peptide YY (PYY), human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
