CAT# | L13008 |
Sequence | EKSCTTWRNSCMHNDKGCCFPWSCVCWSQTVSRNSSRKEKKCQCRLW |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...
Figure 1. Chemical structure of lysipressinLysipressin ([Lys8]-vasopressin) has been identified in the North Ame ...
Tertiapin-Q (TPN-Q) is a small compact protein that contains twenty-one amino acids, which derived from bee veno ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...