CAT# | L13004 |
Sequence | ERSCITWRNSCMHNDKGCCFPWSCVCWSQTVSRNSSRKEKKCQCRLW |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
PAC-113, as well as a new type of Trp-rich peptide, is a 12 amino-acid fragment of the saliva protein histatin 5 ...
Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...